Sermorelin (10mg)

Description

What is Sermorelin?

Sermorelin (GRF 1-29 NH2) is the shortest fully active fragment of endogenous growth hormone-releasing hormone (GHRH). It was previously FDA-approved as Geref for the diagnosis and treatment of pediatric growth hormone deficiency and has been studied extensively in GH stimulation testing and in adult GH axis research.

Mechanism of Action

• Binds the GHRH receptor (GHRHR) on anterior pituitary somatotrophs.
• Activates adenylate cyclase and the cAMP/PKA pathway, stimulating synthesis and pulsatile release of endogenous GH.
• Preserves physiological feedback — unlike exogenous rhGH, sermorelin-driven GH release remains subject to somatostatin inhibition.
• Synergistic with GHS-R1a agonists (e.g., ipamorelin, GHRP-2) in producing amplified GH pulses.

Compound Properties

• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (29 aa)
• Molecular formula: C149H246N44O42S
• Molecular weight: 3357.88 g/mol
• CAS number: 86168-78-7
• Form: Lyophilized powder
• Unit size: 10 mg / vial
• PubChem CID: 16129620

Research-Reference Dosing

The following protocols are drawn from the published clinical and diagnostic literature for laboratory research reference only.

• Thorner et al. (Journal of Clinical Endocrinology & Metabolism, 1988): pediatric GHD studies at 0.03 mg/kg subcutaneously once nightly.
• Prakash & Goa (BioDrugs, 1999): diagnostic GH stimulation testing using 1 μg/kg IV.
• Walker (Clinical Interventions in Aging, 2006): review of adult GH axis studies using 0.2–0.5 mg nightly subcutaneous dosing ranges.

Research Findings (Published Human Data)

• Thorner 1988 and subsequent Geref registration trials: restored height velocity in pediatric GHD comparable to daily rhGH across multi-year treatment.
• Prakash 1999: reliable, reproducible GH response for diagnostic testing; established as a validated provocative stimulus.
• Small adult cohort studies have reported increases in IGF-1 and improvements in body composition markers, but these have not been replicated in large, randomized, placebo-controlled trials.

Known Side Effects Reported in Trials

• Common and mild: injection-site pain/erythema, flushing, headache, transient nausea, dysgeusia.
• Uncommon: vomiting, pallor, chest tightness.
• Rare: hypersensitivity reactions. Geref prescribing information cited no significant effect on cortisol, prolactin, or TSH.

Storage & Handling

Store lyophilized vial at -20 °C protected from light. Reconstitute with bacteriostatic water and store refrigerated at 2–8 °C; use within 14 days.

Certificate of Analysis

A batch-specific Certificate of Analysis (CoA) including HPLC purity, mass spectrometry identity confirmation, and endotoxin testing is available upon request for each production lot.